Online Database of Chemicals from Around the World

Human growth hormone
[CAS 12629-01-5]

List of Suppliers
Zouping Mingxing Chemical Co., Ltd. China
www.zoutong.com.cn
+86 13605431940
+86 (543) 224-0079
sdzpmxchem@126.com
QQ Chat
Skype Chat
Chemical manufacturer since 2003
chemBlink Standard supplier since 2006
Hefei TNJ Chemical Industry Co., Ltd. China
www.tnjchem.com
+86 (551) 6541-8684
+86 (551) 6541-8697
sales@tnjchem.com
Chemical manufacturer since 2001
chemBlink Standard supplier since 2010
BOC Sciences USA
www.bocsci.com
+1 (631) 485-4226
+1 (631) 614-7828
info@bocsci.com
Chemical manufacturer
chemBlink Standard supplier since 2010
Chengdu Youngshe Chemical Co., Ltd. China
www.youngshechem.com
+86 (28) 6232-8193
+86 17380623303
+86 (28) 6232-8193
caroline@youngshechem.com
QQ Chat
Skype Chat
Chemical manufacturer since 2013
chemBlink Standard supplier since 2015
Qijian Bio-pharmaceutical Co.,ltd. China
www.qijianbio.com
+86 (431) 8128-5900
+86 (431) 8879-4098
export@qijianbio.com
Chemical manufacturer since 2004
chemBlink Standard supplier since 2016
Shanghai Yingrui Biopharm Co., Ltd. China
www.shyrchem.com
+86 (21) 3358-5366
3466-6753
+86 13311639313
+86 (21) 3497-9012
sales02@shyrchem.com
QQ Chat
Skype Chat
Chemical manufacturer since 2009
chemBlink Standard supplier since 2017
Nantong Guangyuan Chemical Co., Ltd. China
www.guyunchem.com
+86 17778744832
yoko@guyunchem.com
Skype Chat
WeChat: 17778744832
WhatsApp:+86 17778744832
Chemical distributor since 2022
chemBlink Standard supplier since 2023
Qijian Bio-pharmaceutical Co., Ltd. China
www.qjbio.com.cn
+86 17390919497
63161420@qq.com
QQ Chat
Chemical manufacturer since 2004
chemBlink Standard supplier since 2024
Austin Chemical Company, Inc. USA
www.austinchemical.com
+1 (847) 520-9600
+1 (847) 520-9160
info@austinchemical.com
Chemical manufacturer since 1976

Identification
ClassificationAnalytical chemistry >> Standard >> Pharmacopoeia standards and magazine standards
NameHuman growth hormone
SynonymsSomatotropin
Molecular StructureHuman growth hormone molecular structure (CAS 12629-01-5)
Molecular FormulaC990H1529N263O299S7
Molecular Weight22124.12
Protein SequenceFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPT$$nl$$PSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEG$$nl$$IQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIV$$nl$$QCRSVEGSCGF
CAS Registry Number12629-01-5
EC Number235-735-8
SMILESCCC(C)C(C(=O)N1CCCC1C(=NC(CC(C)C)C(=NC(CO)C(=NC(CCCNC(=N)N)C(=NC(CC(C)C)C(=NC(Cc2ccccc2)C(=NC(CC(=O)O)C(=NC(CC(=N)O)C(=NC(C)C(=NC(CCSC)C(=NC(CC(C)C)C(=O)O)O)O)O)O)O)O)O)O)O)O)N=C(C(C(C)O)N=C(C3CCCN3C(=O)C(Cc4ccccc4)N)O)O
Properties
Density1.4±0.1 g/cm3, Calc.*
Index of Refraction1.642, Calc.*
Boiling Point1580.5±75.0 °C (760 mmHg), Calc.*
Flash Point909.7±37.1 °C, Calc.*
*Calculated using Advanced Chemistry Development (ACD/Labs) Software.
Safety Data
Safety StatementsP264-P270-P273-P280-P301+P312+P330-P302+P352+P312-P305+P351+P338+P310-P332+P313-P391-P501  Details
Hazard Classification
up    Details
HazardClassCategory CodeHazard Statement
Acute toxicityAcute Tox.3H301
Reproductive toxicityRepr.2H361
Acute toxicityAcute Tox.4H332
Acute toxicityAcute Tox.4H312
Skin sensitizationSkin Sens.1H317
Specific target organ toxicity - single exposureSTOT SE3H335
SDSAvailable
up Discovery and Applications
Human growth hormone (hGH), also known as somatotropin, was first isolated in the 1950s. Its discovery is attributed to the pioneering work of endocrinologists who were studying the pituitary gland and its role in growth and development. Maurice Raben, an American endocrinologist, successfully extracted hGH from human cadaver pituitary glands in 1956, marking a significant breakthrough in medical science. This discovery paved the way for the use of hGH in treating growth disorders. In 1985, recombinant DNA technology enabled the production of synthetic hGH.

Human growth hormone has a wide range of applications in medicine and other fields, primarily focusing on growth disorders, metabolic functions, and anti-aging treatments.hGH is extensively used to treat children with growth hormone deficiency (GHD), which results in stunted growth and delayed development. By administering synthetic hGH, children can achieve normal growth rates and improve their overall physical development. It is also used for other conditions such as Turner syndrome, chronic kidney disease, and Prader-Willi syndrome, which are associated with growth delays.

Adults with GHD can also benefit from hGH therapy. The condition in adults can lead to decreased muscle mass, increased body fat, and diminished quality of life. hGH supplementation helps improve body composition, increase bone density, enhance physical strength, and improve overall well-being. It also supports cardiovascular health by improving lipid profiles and reducing cardiovascular risk factors.

hGH is used in managing muscle-wasting diseases, such as those associated with HIV/AIDS and short bowel syndrome. Its anabolic properties help maintain lean body mass, improve muscle strength, and enhance overall energy levels in patients suffering from these debilitating conditions.

While controversial and not universally approved, hGH is sometimes used off-label for its purported anti-aging benefits. Proponents claim that it can reduce body fat, increase muscle mass, improve skin elasticity, and boost overall energy levels.

Although banned by most sports organizations, hGH is sometimes used illegally by athletes to enhance performance. It is believed to increase muscle mass, reduce recovery times, and improve overall physical performance. The use of hGH for doping is controversial and poses significant health risks, leading to strict regulations and testing in competitive sports.

hGH is used in rehabilitation medicine to aid recovery from major surgeries, severe burns, and traumatic injuries. Its ability to promote tissue repair, muscle growth, and overall recovery accelerates the healing process and improves outcomes for patients undergoing intensive rehabilitation.

References

none
Market Analysis Reports
Related Products
Human calcitoni...  Human calcitoni...  Human calcitoni...  Human chorionic...  DNA (Human Clon...  Human M-CSF  Human endotheli...  Human Gastrin I...  Human glicentin...  Human GLP-1 (7-...  Human growth ho...  (1-34)-Humanhum...  Human Inhibin A  Human Insulin-L...  Human kinetensi...  Human Leukocyte...  Human beta-lipo...  Human beta-mela...  Human menopausa...  Human neuropept...