Online Database of Chemicals from Around the World

Dulaglutide
[CAS 923950-08-7]

List of Suppliers
Taizhou Crene Biotechnology Co., Ltd. China
www.pharm-intermediates.com
+86 (576) 8881-3233
8820-5808
+86 13396860566
+86 (576) 8822-9589
sales@pharm-intermediates.com
QQ Chat
Chemical manufacturer since 2011
chemBlink Standard supplier since 2009
Shanghai Min-biotech Co., Ltd. China
www.min-biotech.com
+86 15190045345
sales@min-biotech.com
Chemical manufacturer since 2017
chemBlink Standard supplier since 2024

Identification
ClassificationAPI >> Other chemicals
NameDulaglutide
SynonymsLY 2189265; Trulicity
Molecular StructureDulaglutide molecular structure (CAS 923950-08-7)
Molecular FormulaC2646H4044N704O836S18
Molecular Weight59669.81
Protein SequenceHGEGTFTSDVSSYLEEQAAKEFIAWLVKGGGGGGGSGGGGSGGGGSAESKYGPPCPPCPA$$nl$$PEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKP$$nl$$REEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTL$$nl$$PPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLT$$nl$$VDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLG
CAS Registry Number923950-08-7
up Discovery and Applications
Dulaglutide, a medication used in the management of type 2 diabetes, was developed by Eli Lilly and Company. It belongs to a class of drugs known as glucagon-like peptide-1 receptor agonists (GLP-1 RAs), which mimic the action of endogenous incretin hormones to regulate blood sugar levels. The discovery of dulaglutide stemmed from research into novel therapeutic approaches for diabetes management.

Dulaglutide, a glucagon-like peptide-1 receptor agonist, is widely used in the management of type 2 diabetes mellitus. By mimicking the action of endogenous incretin hormones, dulaglutide helps regulate blood sugar levels by stimulating insulin secretion, inhibiting glucagon release, and slowing gastric emptying. It is administered via subcutaneous injection and is indicated as an adjunct to diet and exercise in patients with inadequately controlled diabetes. Clinical studies have demonstrated the efficacy of dulaglutide in reducing hemoglobin A1c levels, promoting weight loss, and lowering the risk of cardiovascular events in patients with type 2 diabetes. Additionally, dulaglutide has shown benefits in improving pancreatic beta-cell function and may offer advantages in terms of dosing frequency and tolerability compared to some other antidiabetic medications.

References

2022. Once-Weekly Dulaglutide for the Treatment of Youths with Type 2 Diabetes. The New England journal of medicine, 387(5).
DOI: 10.1056/nejmoa2204601

2020. The protective effects of dulaglutide against advanced glycation end products (AGEs)-induced degradation of type - collagen and aggrecan in human SW1353 chondrocytes. Chemico-Biological Interactions, 322.
DOI: 10.1016/j.cbi.2020.108968

2010. Engineering and characterization of the long‐acting glucagon‐like peptide‐1 analogue LY2189265, an Fc fusion protein. Diabetes/Metabolism Research and Reviews, 26(4).
DOI: 10.1002/dmrr.1080
Market Analysis Reports
Related Products
DSPE-PEG2000-MA...  DSPE-PEG-NHS  DT12-18  DTP348  DTPA-BMA  Dtpa Ferric Che...  (Dtpa-Phe(1))-O...  (1R,1'R,2S,2'S)...  Ducheside A  Duclauxin  Dulanermin  Dulcerozine  Dulcioic acid  Dulcitol  Dulcoside A  Dulofibrate  Duloxetine  Duloxetine  (R)-Duloxetine  Duloxetine-d7